Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00084901-B01P |
Product name: | NFATC2IP purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human NFATC2IP protein. |
Gene id: | 84901 |
Gene name: | NFATC2IP |
Gene alias: | FLJ14639|MGC126790|MGC138387 |
Gene description: | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein |
Genbank accession: | BC021551 |
Immunogen: | NFATC2IP (AAH21551.1, 1 a.a. ~ 138 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG |
Protein accession: | AAH21551.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NFATC2IP expression in transfected 293T cell line (H00084901-T02) by NFATC2IP MaxPab polyclonal antibody. Lane 1: NFATC2IP transfected lysate(15.18 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |