Brand: | Abnova |
Reference: | H00064318-M04 |
Product name: | NOC3L monoclonal antibody (M04), clone 5E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NOC3L. |
Clone: | 5E8 |
Isotype: | IgG1 Kappa |
Gene id: | 64318 |
Gene name: | NOC3L |
Gene alias: | AD24|C10orf117|FAD24|FLJ12820 |
Gene description: | nucleolar complex associated 3 homolog (S. cerevisiae) |
Genbank accession: | NM_022451 |
Immunogen: | NOC3L (NP_071896, 702 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH |
Protein accession: | NP_071896 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NOC3L is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |