Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of POMC polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,IHC,Dot |
More info about POMC polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB8938 |
| Product name: | POMC polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of POMC. |
| Gene id: | 5443 |
| Gene name: | POMC |
| Gene alias: | ACTH|CLIP|LPH|MSH|NPP|POC |
| Gene description: | proopiomelanocortin |
| Immunogen: | A synthetic peptide corresponding to amino acids 138-176 of human POMC. |
| Immunogen sequence/protein sequence: | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) Immunoprecipitation (1:200) Immunohistochemistry (1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In buffer containing 0.02% sodium azide |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Synthetic Peptide. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Applications: | WB,IHC,Dot |
| Shipping condition: | Dry Ice |
| Publications: | The tissue-specific processing of pro-opiomelanocortin.Bicknell AB. J Neuroendocrinol. 2008 Jun;20(6):692-9. |