Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Exendin-4 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Host species | Rabbit |
| Applications | IP,EIA |
More info about Exendin-4 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB5186 |
| Product name: | Exendin-4 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of exendin-4. |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide (conjugated with KLH) corresponding to exendin-4. |
| Immunogen sequence/protein sequence: | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Form: | Liquid |
| Recommend dilutions: | The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.4 (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Applications: | IP,EIA |
| Shipping condition: | Dry Ice |