| Brand: | Abnova |
| Reference: | PAB5082 |
| Product name: | Nppb polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of Nppb. |
| Gene id: | 25105 |
| Gene name: | Nppb |
| Gene alias: | BNP|Bnf |
| Gene description: | natriuretic peptide precursor B |
| Immunogen: | A synthetic peptide (conjugated with KLH) corresponding to rat Nppb. |
| Immunogen sequence/protein sequence: | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF |
| Form: | Liquid |
| Recommend dilutions: | The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against synthetic peptide. |
| Note: | This product contains thimerosal: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Rat |
| Reactivity: | Rat |
| Applications: | IP,EIA |
| Shipping condition: | Dry Ice |