| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | IHC-P |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human GPR84. |
| Isotype: | IgG |
| Gene id: | 53831 |
| Gene name: | GPR84 |
| Gene alias: | EX33|GPCR4 |
| Gene description: | G protein-coupled receptor 84 |
| Immunogen: | Recombinant protein corresponding to human GPR84. |
| Immunogen sequence/protein sequence: | TTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTR |
| Protein accession: | Q9NQS5 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 uL |
| Shipping condition: | Dry Ice |