Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TCF4 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about TCF4 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30954 |
| Product name: | TCF4 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human TCF4. |
| Isotype: | IgG |
| Gene id: | 6925 |
| Gene name: | TCF4 |
| Gene alias: | E2-2|ITF2|MGC149723|MGC149724|PTHS|SEF2|SEF2-1|SEF2-1A|SEF2-1B|bHLHb19 |
| Gene description: | transcription factor 4 |
| Immunogen: | Recombinant protein corresponding to human TCF4. |
| Immunogen sequence/protein sequence: | HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD |
| Protein accession: | P15884 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with TCF4 polyclonal antibody (Cat # PAB30954) shows distinct nuclear positivity in seminiferous duct cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Sox4 functions as a positive regulator of β-catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas.Saegusa M, Hashimura M, Kuwata T. Lab Invest. 2012 Apr;92(4):511-21. doi: 10.1038/labinvest.2011.196. Epub 2012 Jan 9. |