GSTP1 polyclonal antibody View larger

GSTP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about GSTP1 polyclonal antibody

Brand: Abnova
Reference: PAB30867
Product name: GSTP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human GSTP1.
Isotype: IgG
Gene id: 2950
Gene name: GSTP1
Gene alias: DFN7|FAEES3|GST3|PI
Gene description: glutathione S-transferase pi 1
Immunogen: Recombinant protein corresponding to human GSTP1.
Immunogen sequence/protein sequence: TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS
Protein accession: P09211
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30867-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with GSTP1 polyclonal antibody (Cat # PAB30867) (Green) shows positivity in cytoplasm and mitochondria.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice
Publications: Breast Cancer Proteomics - Differences in Protein Expression between Estrogen Receptor-Positive and -Negative Tumors Identified by Tandem Mass Tag Technology.Ruckhaberle E, Karn T, Hanker L, Schwarz J, Schulz-Knappe P, Kuhn K, Bohm G, Selzer S, Erhard N, Engels K, Holtrich U, Kaufmann M, Rody A.
Breast Care (Basel). 2010 Mar;5(1):7-10. Epub 2010 Feb 16.

Reviews

Buy GSTP1 polyclonal antibody now

Add to cart