Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GSTP1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
More info about GSTP1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30867 |
| Product name: | GSTP1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human GSTP1. |
| Isotype: | IgG |
| Gene id: | 2950 |
| Gene name: | GSTP1 |
| Gene alias: | DFN7|FAEES3|GST3|PI |
| Gene description: | glutathione S-transferase pi 1 |
| Immunogen: | Recombinant protein corresponding to human GSTP1. |
| Immunogen sequence/protein sequence: | TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS |
| Protein accession: | P09211 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of U-2 OS with GSTP1 polyclonal antibody (Cat # PAB30867) (Green) shows positivity in cytoplasm and mitochondria. |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Breast Cancer Proteomics - Differences in Protein Expression between Estrogen Receptor-Positive and -Negative Tumors Identified by Tandem Mass Tag Technology.Ruckhaberle E, Karn T, Hanker L, Schwarz J, Schulz-Knappe P, Kuhn K, Bohm G, Selzer S, Erhard N, Engels K, Holtrich U, Kaufmann M, Rody A. Breast Care (Basel). 2010 Mar;5(1):7-10. Epub 2010 Feb 16. |