Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of INA polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,IHC-P,IF |
More info about INA polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30792 |
| Product name: | INA polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human INA. |
| Isotype: | IgG |
| Gene id: | 9118 |
| Gene name: | INA |
| Gene alias: | FLJ18662|FLJ57501|MGC12702|NEF5|NF-66|TXBP-1 |
| Gene description: | internexin neuronal intermediate filament protein, alpha |
| Immunogen: | Recombinant protein corresponding to human INA. |
| Immunogen sequence/protein sequence: | ALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQ |
| Protein accession: | Q16352 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of A549 (A), mouse dentate gyrus (B), mouse olfactory bulb (C), mouse dorsal tenia tecta (D) and mouse medulla (E) with INA polyclonal antibody (Cat # PAB30792) (Green). A: A549 shows positivity in nuclear membrane, intermediate filaments and nucleus but excluded from the nucleoli. B: Mouse dentate gyrus shows selective immunoreactivity in a subset of granular cells and their dendrites. C: Mouse olfactory bulb shows strong positivity in neuronal processes and some cell bodies in the external plexiform layer. D: Mouse dorsal tenia tecta shows selective immunoreactivity in a subset of neurons. E: Mouse medulla shows distinct staining of nerve bundles. |
| Applications: | WB-Ce,WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |