MLLT10 polyclonal antibody View larger

MLLT10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MLLT10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MLLT10 polyclonal antibody

Brand: Abnova
Reference: PAB30747
Product name: MLLT10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MLLT10.
Isotype: IgG
Gene id: 8028
Gene name: MLLT10
Gene alias: AF10|DKFZp686E10210|MGC75086
Gene description: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10
Immunogen: Recombinant protein corresponding to human MLLT10.
Immunogen sequence/protein sequence: TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSV
Protein accession: P55197
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30747-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with MLLT10 polyclonal antibody (Cat # PAB30747) (Green) shows positivity in nucleus but excluded from the nucleoli.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MLLT10 polyclonal antibody now

Add to cart