VASP polyclonal antibody View larger

VASP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VASP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P,IF

More info about VASP polyclonal antibody

Brand: Abnova
Reference: PAB30746
Product name: VASP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human VASP.
Isotype: IgG
Gene id: 7408
Gene name: VASP
Gene alias: -
Gene description: vasodilator-stimulated phosphoprotein
Immunogen: Recombinant protein corresponding to human VASP.
Immunogen sequence/protein sequence: PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
Protein accession: P50552
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB30746-49-4-1.jpg
Application image note: Immunofluorescent staining of A-431 cells with VASP polyclonal antibody (Cat # PAB30746) (Green) shows positivity in plasma membrane, cytoplasm and focal adhesion sites.
Applications: WB,WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy VASP polyclonal antibody now

Add to cart