Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 215,34 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 215,34 €
Data sheet of DDX3X polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,IHC-P,IF |
More info about DDX3X polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30744 |
| Product name: | DDX3X polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human DDX3X. |
| Isotype: | IgG |
| Gene id: | 1654 |
| Gene name: | DDX3X |
| Gene alias: | DBX|DDX14|DDX3|HLP2 |
| Gene description: | DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked |
| Immunogen: | Recombinant protein corresponding to human DDX3X. |
| Immunogen sequence/protein sequence: | LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGG |
| Protein accession: | O00571 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of U-251 MG with DDX3X polyclonal antibody (Cat # PAB30744) (Green) shows positivity in cytoplasm. |
| Applications: | WB-Ce,WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |