TPX2 polyclonal antibody View larger

TPX2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TPX2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about TPX2 polyclonal antibody

Brand: Abnova
Reference: PAB30737
Product name: TPX2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human TPX2.
Isotype: IgG
Gene id: 22974
Gene name: TPX2
Gene alias: C20orf1|C20orf2|DIL-2|DIL2|FLS353|GD:C20orf1|HCA519|HCTP4|REPP86|p100
Gene description: TPX2, microtubule-associated, homolog (Xenopus laevis)
Immunogen: Recombinant protein corresponding to human TPX2.
Immunogen sequence/protein sequence: QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Protein accession: Q9ULW0
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30737-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with TPX2 polyclonal antibody (Cat # PAB30737) (Green) shows positivity in nucleus but excluded from the nucleoli.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TPX2 polyclonal antibody now

Add to cart