Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARHGAP1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,IHC-P,IF |
More info about ARHGAP1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30697 |
| Product name: | ARHGAP1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human ARHGAP1. |
| Isotype: | IgG |
| Gene id: | 392 |
| Gene name: | ARHGAP1 |
| Gene alias: | CDC42GAP|RHOGAP|RHOGAP1|p50rhoGAP |
| Gene description: | Rho GTPase activating protein 1 |
| Immunogen: | Recombinant protein corresponding to human ARHGAP1. |
| Immunogen sequence/protein sequence: | SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS |
| Protein accession: | Q07960 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of U-251 MG (A), mouse dentate gyrus (B), mouse cingulate cortex (C), mouse thalamus (D), mouse motor trigeminal nucleus (E) and mouse brain (F) with ARHGAP1 polyclonal antibody (Cat # PAB30697) (Green). A: U-251 MG shows positivity in vesicles. B: Mouse dentate gyrus shows immunoreactivity in polymorph layer. C: Mouse cingulate cortex shows cytoplasmic immunoreactivity in neurons. D: Mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus. E: Mouse motor trigeminal nucleus shows positivity in neuronal cells bodies and processes. F: Mouse brain shows neuronal staining in lateral paragigantocellular nucleus. |
| Applications: | WB-Ce,WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |