Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZNF3 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | IHC-P,IF |
More info about ZNF3 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30639 |
| Product name: | ZNF3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human ZNF3. |
| Isotype: | IgG |
| Gene id: | 7551 |
| Gene name: | ZNF3 |
| Gene alias: | A8-51|FLJ20216|HF.12|KOX25|PP838|Zfp113 |
| Gene description: | zinc finger protein 3 |
| Immunogen: | Recombinant protein corresponding to human ZNF3. |
| Immunogen sequence/protein sequence: | SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRK |
| Protein accession: | P17036 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunofluorescent staining of U-251 MG (A), mouse midbrain (B), mouse piriform cortex (C), mouse hypothalamus (D, E) and mouse visual cortex (F) with ZNF3 polyclonal antibody (Cat # PAB30639) (Green). A: U-251 MG shows positivity in nucleus but excluded from the nucleoli. B: Mouse midbrain shows nuclear staining in neurons of the oculomotor and red nuclei. C: Mouse piriform cortex shows nuclear staining in the neurons of layer 2. D: Mouse hypothalamus shows nuclear positivity in the neurons of medial preoptic area. E: Mouse hypothalamus shows nuclear immunoreactivity in the neurons in the arcuate nucleus. F: Mouse visual cortex shows nuclear positivity in neurons. |
| Applications: | IHC-P,IF |
| Shipping condition: | Dry Ice |