RBM3 polyclonal antibody View larger

RBM3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBM3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about RBM3 polyclonal antibody

Brand: Abnova
Reference: PAB30635
Product name: RBM3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human RBM3.
Isotype: IgG
Gene id: 5935
Gene name: RBM3
Gene alias: IS1-RNPL|RNPL
Gene description: RNA binding motif (RNP1, RRM) protein 3
Immunogen: Recombinant protein corresponding to human RBM3.
Immunogen sequence/protein sequence: DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
Protein accession: P98179
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB30635-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with RBM3 polyclonal antibody (Cat # PAB30635) (Green) shows positivity in nucleus but excluded from the nucleoli.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy RBM3 polyclonal antibody now

Add to cart