SEPT3 polyclonal antibody View larger

SEPT3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEPT3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about SEPT3 polyclonal antibody

Brand: Abnova
Reference: PAB30628
Product name: SEPT3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SEPT3.
Isotype: IgG
Gene id: 55964
Gene name: SEPT3
Gene alias: MGC133218|SEP3|bK250D10.3
Gene description: septin 3
Immunogen: Recombinant protein corresponding to human SEPT3.
Immunogen sequence/protein sequence: LSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGG
Protein accession: Q9UH03
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30628-49-187-1.jpg
Application image note: Immunofluorescent staining of U-251 MG with SEPT3 polyclonal antibody (Cat # PAB30628) (Green) shows positivity in plasma membrane and nucleus but excluded from the nucleoli.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SEPT3 polyclonal antibody now

Add to cart