JAM3 polyclonal antibody View larger

JAM3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of JAM3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about JAM3 polyclonal antibody

Brand: Abnova
Reference: PAB30620
Product name: JAM3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human JAM3.
Isotype: IgG
Gene id: 83700
Gene name: JAM3
Gene alias: FLJ14529|JAM-C|JAMC
Gene description: junctional adhesion molecule 3
Immunogen: Recombinant protein corresponding to human JAM3.
Immunogen sequence/protein sequence: RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG
Protein accession: Q9BX67
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30620-49-187-1.jpg
Application image note: Immunofluorescent staining of U-251 MG with JAM3 polyclonal antibody (Cat # PAB30620) (Green) shows positivity in the Golgi apparatus.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy JAM3 polyclonal antibody now

Add to cart