BRD4 polyclonal antibody View larger

BRD4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BRD4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about BRD4 polyclonal antibody

Brand: Abnova
Reference: PAB30602
Product name: BRD4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human BRD4.
Isotype: IgG
Gene id: 23476
Gene name: BRD4
Gene alias: CAP|HUNK1|HUNKI|MCAP
Gene description: bromodomain containing 4
Immunogen: Recombinant protein corresponding to amino acids 1031-1172 of human BRD4.
Immunogen sequence/protein sequence: PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Protein accession: O60885
Form: Liquid
Recommend dilutions: Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30602-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with BRD4 polyclonal antibody (Cat # PAB30602) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy BRD4 polyclonal antibody now

Add to cart