BRWD3 polyclonal antibody View larger

BRWD3 polyclonal antibody

New product

375,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BRWD3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsIHC-P,IF

More info about BRWD3 polyclonal antibody

Reference: PAB30593
Product name: BRWD3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human BRWD3.
Isotype: IgG
Gene id: 254065
Gene name: BRWD3
Gene alias: BRODL|FLJ38568|MRX93
Gene description: bromodomain and WD repeat domain containing 3
Immunogen: Recombinant protein corresponding to amino acids 605-748 of human BRWD3.
Immunogen sequence/protein sequence: VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDLRLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSRVQEE
Protein accession: Q6RI45
Form: Liquid
Recommend dilutions: Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Shipping condition: Dry Ice

Reviews

Buy BRWD3 polyclonal antibody now

Add to cart