| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,IF |
| Brand: | Abnova |
| Reference: | PAB30578 |
| Product name: | PHF2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human PHF2. |
| Isotype: | IgG |
| Gene id: | 5253 |
| Gene name: | PHF2 |
| Gene alias: | GRC5|JHDM1E|KIAA0662|MGC176680 |
| Gene description: | PHD finger protein 2 |
| Immunogen: | Recombinant protein corresponding to amino acids 589-724 of human PHF2. |
| Immunogen sequence/protein sequence: | LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD |
| Protein accession: | O75151 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1 - 4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescent staining of human cell line U-2 OS with PHF2 polyclonal antibody (Cat # PAB30578) shows positivity in nucleus and nucleoli. Antibody staining is shown in green. |
| Applications: | IHC-P,IF |
| Shipping condition: | Dry Ice |