NEK7 polyclonal antibody View larger

NEK7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEK7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about NEK7 polyclonal antibody

Brand: Abnova
Reference: PAB30543
Product name: NEK7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human NEK7.
Isotype: IgG
Gene id: 140609
Gene name: NEK7
Gene alias: -
Gene description: NIMA (never in mitosis gene a)-related kinase 7
Immunogen: Recombinant protein corresponding to human NEK7.
Immunogen sequence/protein sequence: VCLLPVWERRVCALNACYFLEIIKGSESLQYMATLTNLFENLPVSHHGSFA
Protein accession: Q8TDX7
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30543-48-4-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with NEK7 polyclonal antibody (Cat # PAB30543) shows strong positivity in chief cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NEK7 polyclonal antibody now

Add to cart