Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB30531 |
Product name: | NFKBIA polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant human NFKBIA. |
Isotype: | IgG |
Gene id: | 4792 |
Gene name: | NFKBIA |
Gene alias: | IKBA|MAD-3|NFKBI |
Gene description: | nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha |
Immunogen: | Recombinant protein corresponding to human NFKBIA. |
Immunogen sequence/protein sequence: | MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG |
Protein accession: | P25963 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human urinary bladder with NFKBIA polyclonal antibody (Cat # PAB30531) shows strong cytoplasmic positivity in urothelial cells. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |