CASP6 polyclonal antibody View larger

CASP6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CASP6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about CASP6 polyclonal antibody

Brand: Abnova
Reference: PAB30528
Product name: CASP6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CASP6.
Isotype: IgG
Gene id: 839
Gene name: CASP6
Gene alias: MCH2
Gene description: caspase 6, apoptosis-related cysteine peptidase
Immunogen: Recombinant protein corresponding to human CASP6.
Immunogen sequence/protein sequence: DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQV
Protein accession: P55212
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30528-48-7-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with CASP6 polyclonal antibody (Cat # PAB30528) shows strong cytoplasmic positivity in glandular cells.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CASP6 polyclonal antibody now

Add to cart