OTUD5 polyclonal antibody View larger

OTUD5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OTUD5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about OTUD5 polyclonal antibody

Brand: Abnova
Reference: PAB30519
Product name: OTUD5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human OTUD5.
Isotype: IgG
Gene id: 55593
Gene name: OTUD5
Gene alias: DKFZp761A052|DUBA|MGC104871
Gene description: OTU domain containing 5
Immunogen: Recombinant protein corresponding to amino acids 439 - 555 of human OTUD5.
Immunogen sequence/protein sequence: AAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLD
Protein accession: Q96G74
Form: Liquid
Recommend dilutions: Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30519-48-258-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum using OTUD5 polyclonal antibody (Cat # PAB30519) shows cytoplasmic positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy OTUD5 polyclonal antibody now

Add to cart