CDH8 polyclonal antibody View larger

CDH8 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDH8 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CDH8 polyclonal antibody

Brand: Abnova
Reference: PAB30492
Product name: CDH8 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CDH8.
Isotype: IgG
Gene id: 1006
Gene name: CDH8
Gene alias: Nbla04261
Gene description: cadherin 8, type 2
Immunogen: Recombinant protein corresponding to human CDH8.
Immunogen sequence/protein sequence: TLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKSYTLKVEAANVHIDPRFSGRGPFKDTAT
Protein accession: P55286
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30492-48-7-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with CDH8 polyclonal antibody (Cat # PAB30492) shows strong cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CDH8 polyclonal antibody now

Add to cart