TAC1 polyclonal antibody View larger

TAC1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAC1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TAC1 polyclonal antibody

Brand: Abnova
Reference: PAB30483
Product name: TAC1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human TAC1.
Isotype: IgG
Gene id: 6863
Gene name: TAC1
Gene alias: Hs.2563|NK2|NKNA|NPK|TAC2
Gene description: tachykinin, precursor 1
Immunogen: Recombinant protein corresponding to human TAC1.
Immunogen sequence/protein sequence: WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR
Protein accession: P20366
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TAC1 polyclonal antibody now

Add to cart