CELSR2 polyclonal antibody View larger

CELSR2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CELSR2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CELSR2 polyclonal antibody

Brand: Abnova
Reference: PAB30476
Product name: CELSR2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CELSR2.
Isotype: IgG
Gene id: 1952
Gene name: CELSR2
Gene alias: CDHF10|EGFL2|FLJ34118|FLJ42737|FLJ45143|FLJ45845|Flamingo1|KIAA0279|MEGF3
Gene description: cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
Immunogen: Recombinant protein corresponding to human CELSR2.
Immunogen sequence/protein sequence: SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAGPGEAQEPEELARRQRRHPELSQ
Protein accession: Q9HCU4
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30476-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with CELSR2 polyclonal antibody (Cat # PAB30476) shows strong nuclear and cytoplasmic positivity in neuronal cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CELSR2 polyclonal antibody now

Add to cart