CD180 polyclonal antibody View larger

CD180 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD180 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CD180 polyclonal antibody

Brand: Abnova
Reference: PAB30355
Product name: CD180 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CD180.
Isotype: IgG
Gene id: 4064
Gene name: CD180
Gene alias: LY64|Ly78|MGC126233|MGC126234|RP105
Gene description: CD180 molecule
Immunogen: Recombinant protein corresponding to human CD180.
Immunogen sequence/protein sequence: DFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKL
Protein accession: Q99467
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30355-48-9-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with CD180 polyclonal antibody (Cat # PAB30355) shows strong cytoplasmic positivity in cells in white pulp at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CD180 polyclonal antibody now

Add to cart