Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AGTR1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | IHC-P |
More info about AGTR1 polyclonal antibody
| Reference: | PAB30349 |
| Product name: | AGTR1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human AGTR1. |
| Isotype: | IgG |
| Gene id: | 185 |
| Gene name: | AGTR1 |
| Gene alias: | AG2S|AGTR1A|AGTR1B|AT1|AT1B|AT1R|AT2R1|AT2R1A|AT2R1B|HAT1R |
| Gene description: | angiotensin II receptor, type 1 |
| Immunogen: | Recombinant protein corresponding to human AGTR1. |
| Immunogen sequence/protein sequence: | LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKP |
| Protein accession: | P30556 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Shipping condition: | Dry Ice |