T polyclonal antibody View larger

T polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of T polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about T polyclonal antibody

Brand: Abnova
Reference: PAB30336
Product name: T polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human T.
Isotype: IgG
Gene id: 6862
Gene name: T
Gene alias: MGC104817|TFT
Gene description: T, brachyury homolog (mouse)
Immunogen: Recombinant protein corresponding to human T.
Immunogen sequence/protein sequence: QQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQY
Protein accession: O15178
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30336-48-70-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human bone marrow with T polyclonal antibody (Cat # PAB30336) shows moderate nuclear positivity in a subset of bone marrow poietic cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy T polyclonal antibody now

Add to cart