| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | IHC-P |
| Reference: | PAB30306 |
| Product name: | NCR2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human NCR2. |
| Isotype: | IgG |
| Gene id: | 9436 |
| Gene name: | NCR2 |
| Gene alias: | CD336|LY95|NK-p44|NKP44|dJ149M18.1 |
| Gene description: | natural cytotoxicity triggering receptor 2 |
| Immunogen: | Recombinant protein corresponding to amino acids 35-104 of human NCR2. |
| Immunogen sequence/protein sequence: | TLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDS |
| Protein accession: | O95944 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Shipping condition: | Dry Ice |