BID polyclonal antibody View larger

BID polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BID polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about BID polyclonal antibody

Brand: Abnova
Reference: PAB30245
Product name: BID polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human BID.
Isotype: IgG
Gene id: 637
Gene name: BID
Gene alias: FP497|MGC15319|MGC42355
Gene description: BH3 interacting domain death agonist
Immunogen: Recombinant protein corresponding to amino acids of human BID.
Immunogen sequence/protein sequence: VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
Protein accession: P55957
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30245-48-9-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with BID polyclonal antibody (Cat # PAB30245) shows strong cytoplasmic positivity in cells in red pulp at 1:1000 - 1:2500 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy BID polyclonal antibody now

Add to cart