SOD2 polyclonal antibody View larger

SOD2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOD2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P

More info about SOD2 polyclonal antibody

Brand: Abnova
Reference: PAB30220
Product name: SOD2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SOD2.
Isotype: IgG
Gene id: 6648
Gene name: SOD2
Gene alias: IPO-B|MNSOD|Mn-SOD
Gene description: superoxide dismutase 2, mitochondrial
Immunogen: Recombinant protein corresponding to amino acids 6 - 150 of human SOD2.
Immunogen sequence/protein sequence: VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL
Protein accession: P04179
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB30220-48-7-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon shows strong granular cytoplasmic positivity in glandular cells with SOD2 polyclonal antibody (Cat # PAB30220).
Applications: WB,WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SOD2 polyclonal antibody now

Add to cart