HOXC10 polyclonal antibody View larger

HOXC10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXC10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about HOXC10 polyclonal antibody

Brand: Abnova
Reference: PAB30144
Product name: HOXC10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human HOXC10.
Gene id: 3226
Gene name: HOXC10
Gene alias: HOX3I|MGC5259
Gene description: homeobox C10
Genbank accession: NM_017409
Immunogen: A synthetic peptide corresponding to N-terminus of human HOXC10.
Immunogen sequence/protein sequence: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA
Protein accession: NP_059105;Q9NYD6
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.0625 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30144-48-1-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with HOXC10 polyclonal antibody (Cat # PAB30144) at 4-8 ug/mL working concentration.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HOXC10 polyclonal antibody now

Add to cart