| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,IHC-P |
| Brand: | Abnova |
| Reference: | PAB30112 |
| Product name: | GSTM2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human GSTM2. |
| Gene id: | 2946 |
| Gene name: | GSTM2 |
| Gene alias: | GST4|GSTM|GSTM2-2|GTHMUS|MGC117303 |
| Gene description: | glutathione S-transferase mu 2 (muscle) |
| Genbank accession: | NM_000848 |
| Immunogen: | A synthetic peptide corresponding to N-terminus of human GSTM2. |
| Immunogen sequence/protein sequence: | TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF |
| Protein accession: | NP_000839;P28161 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) Western Blot (0.2-1 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle (A, B) with GSTM2 polyclonal antibody (Cat # PAB30112). |
| Applications: | WB-Ti,IHC-P |
| Shipping condition: | Dry Ice |