Cart 46 Product Products 15 954,37 € (empty)
-
-
-
1 x USP45...259,07 € -
-
-
-
1 x Granzyme H...259,07 € -
-
-
-
-
-
-
-
1 x Phospho-Lc...259,07 € -
-
1 x Ubr1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MRP3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
15 954,37 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 46 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 954,37 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 15 954,37 €
Data sheet of FAM134B polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about FAM134B polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30065 |
| Product name: | FAM134B polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human FAM134B. |
| Gene id: | 54463 |
| Gene name: | FAM134B |
| Gene alias: | FLJ20152|FLJ22155|FLJ22179 |
| Gene description: | family with sequence similarity 134, member B |
| Genbank accession: | NM_019000 |
| Immunogen: | A synthetic peptide corresponding to internal region of human FAM134B. |
| Immunogen sequence/protein sequence: | LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF |
| Protein accession: | NP_061873;Q9H6L5-2 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL) Western Blot (0.625 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with FAM134B polyclonal antibody (Cat # PAB30065) at 4-8 ug/mL working concentration. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |