CREB3L2 polyclonal antibody View larger

CREB3L2 polyclonal antibody

New product

369,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CREB3L2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,IHC-P

More info about CREB3L2 polyclonal antibody

Brand: Abnova
Reference: PAB30010
Product name: CREB3L2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human CREB3L2.
Gene id: 64764
Gene name: CREB3L2
Gene alias: BBF2H7|MGC131709|MGC71006
Gene description: cAMP responsive element binding protein 3-like 2
Genbank accession: NM_194071
Immunogen: A synthetic peptide corresponding to N-terminus of human CREB3L2.
Immunogen sequence/protein sequence: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
Protein accession: NP_919047;Q70SY1
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30010-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CREB3L2 polyclonal antibody (Cat # PAB30010) at 4-8 ug/mL working concentration.
Applications: WB-Ce,WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CREB3L2 polyclonal antibody now

Add to cart