CCL18 polyclonal antibody View larger

CCL18 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL18 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about CCL18 polyclonal antibody

Brand: Abnova
Reference: PAB29990
Product name: CCL18 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against synthetic peptide of human CCL18.
Gene id: 6362
Gene name: CCL18
Gene alias: AMAC-1|AMAC1|CKb7|DC-CK1|DCCK1|MIP-4|PARC|SCYA18
Gene description: chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
Genbank accession: NM_002988
Immunogen: A synthetic peptide corresponding to internal region of human CCL18.
Immunogen sequence/protein sequence: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Protein accession: NP_002979;P55774
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.5 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (2% sucrose, 0.09% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29990-48-E4-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with CCL18 polyclonal antibody (Cat # PAB29990) at 4-8 ug/mL working concentration.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CCL18 polyclonal antibody now

Add to cart