Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HNRNPH1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IP,WB-Ce,IHC-P,IF |
More info about HNRNPH1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29941 |
| Product name: | HNRNPH1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPH1. |
| Gene id: | 3187 |
| Gene name: | HNRNPH1 |
| Gene alias: | DKFZp686A15170|HNRPH|HNRPH1|hnRNPH |
| Gene description: | heterogeneous nuclear ribonucleoprotein H1 (H) |
| Genbank accession: | NM_005520 |
| Immunogen: | A synthetic peptide corresponding to internal region of human HNRNPH1. |
| Immunogen sequence/protein sequence: | FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
| Protein accession: | NP_005511;P31943 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1:200) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (5 ug/mL) Immunoprecipitation (1:4000) Western Blot The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 5 ug/mL working concentration. |
| Applications: | IP,WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |