No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | PAB29922 |
| Product name: | MCM6 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human MCM6. |
| Isotype: | IgG |
| Gene id: | 4175 |
| Gene name: | MCM6 |
| Gene alias: | MCG40308|Mis5|P105MCM |
| Gene description: | minichromosome maintenance complex component 6 |
| Immunogen: | A synthetic peptide corresponding to amino acids 771-820 of human MCM6. |
| Immunogen sequence/protein sequence: | RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE |
| Protein accession: | Q14566 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:250) Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C for up to one week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with MCM6 polyclonal antibody (Cat # PAB29922). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |