Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MIF4GD polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about MIF4GD polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29912 |
| Product name: | MIF4GD polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human MIF4GD. |
| Isotype: | IgG |
| Gene id: | 57409 |
| Gene name: | MIF4GD |
| Gene alias: | AD023|MGC45027|MIFD|SLIP1 |
| Gene description: | MIF4G domain containing |
| Immunogen: | A synthetic peptide corresponding to amino acids 207-256 of human MIF4GD. |
| Immunogen sequence/protein sequence: | LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD |
| Protein accession: | Q8N4Q5 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:250) Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C for up to one week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with MIF4GD polyclonal antibody (Cat # PAB29912). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |