No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human KCNIP1. |
| Isotype: | IgG |
| Gene id: | 30820 |
| Gene name: | KCNIP1 |
| Gene alias: | KCHIP1|MGC95|VABP |
| Gene description: | Kv channel interacting protein 1 |
| Immunogen: | A synthetic peptide corresponding to 50 amino acids at N-terminus of human KCNIP1. |
| Immunogen sequence/protein sequence: | FSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY |
| Protein accession: | Q9NZI2-2 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:250) Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C for up to one week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 uL |
| Shipping condition: | Dry Ice |