Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HNRNPL polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | IP,WB-Ce,IHC-P,IF |
More info about HNRNPL polyclonal antibody
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human HNRNPL. |
| Isotype: | IgG |
| Gene id: | 3191 |
| Gene name: | HNRNPL |
| Gene alias: | FLJ35509|HNRPL|P/OKcl.14|hnRNP-L |
| Gene description: | heterogeneous nuclear ribonucleoprotein L |
| Immunogen: | A synthetic peptide corresponding to amino acids 82-131 of human HNRNPL. |
| Immunogen sequence/protein sequence: | AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
| Protein accession: | P14866 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1:200) Immunohistochemistry (1:250) Immunoprecipitation Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C for up to 1 week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 uL |
| Shipping condition: | Dry Ice |