| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human HTR3B. |
| Isotype: | IgG |
| Gene id: | 9177 |
| Gene name: | HTR3B |
| Gene alias: | 5-HT3B |
| Gene description: | 5-hydroxytryptamine (serotonin) receptor 3B |
| Immunogen: | A synthetic peptide corresponding to amino acids 8-57 of human HTR3B. |
| Immunogen sequence/protein sequence: | PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
| Protein accession: | O95264 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1:250) Immunohistochemistry (1:250) Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Storage instruction: | Store at 4°C for up to 1 week. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 uL |
| Shipping condition: | Dry Ice |