Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ABCB1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | IHC-Fr,IHC-P |
More info about ABCB1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB29562 |
| Product name: | ABCB1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1. |
| Isotype: | IgG |
| Gene id: | 5243 |
| Gene name: | ABCB1 |
| Gene alias: | ABC20|CD243|CLCS|GP170|MDR1|MGC163296|P-GP|PGY1 |
| Gene description: | ATP-binding cassette, sub-family B (MDR/TAP), member 1 |
| Immunogen: | A synthetic peptide corresponding to amino acids 621-650 at internal region of human ABCB1. |
| Immunogen sequence/protein sequence: | IYFKLVTMQTAGNEVELENAADESKSEIDA |
| Form: | Lyophilized |
| Recommend dilutions: | Immunohistochemistry (Frozen sections) (0.5-1 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 0.9 mg NaCl, 0.2 mg Na2HPO4 (5 mg BSA, 0.05 mg sodium azide) |
| Storage instruction: | Store at -20°C. After reconstitution with 0.2 mL of deionized water, store at 4°C for 1 month. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Frozen sections) of mouse intestine tissue (A) and rat kidney tissue (B) with ABCB1 polyclonal antibody (Cat # PAB29562) under 0.5-1 ug/mL working concentration. |
| Applications: | IHC-Fr,IHC-P |
| Shipping condition: | Dry Ice |