CD207 polyclonal antibody View larger

CD207 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD207 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about CD207 polyclonal antibody

Brand: Abnova
Reference: PAB29488
Product name: CD207 polyclonal antibody
Product description: CD207 polyclonal antibody raised against recombinant human CD207.
Isotype: IgG
Gene id: 50489
Gene name: CD207
Gene alias: CLEC4K
Gene description: CD207 molecule, langerin
Immunogen: Recombinant protein corresponding to amino acids of human CD207.
Immunogen sequence/protein sequence: VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Protein accession: Q9UJ71
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB29488-48-72-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with CD207 polyclonal antibody (Cat# PAB29488) shows distinct cytoplasmic positivity in a subset of cells that resembled Langerhans cells at 1:20 - 1:50 dilution.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CD207 polyclonal antibody now

Add to cart