| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
| Brand: | Abnova |
| Reference: | PAB29387 |
| Product name: | RPS6KA3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant human RPS6KA3. |
| Isotype: | IgG |
| Gene id: | 6197 |
| Gene name: | RPS6KA3 |
| Gene alias: | CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|RSK|RSK2|S6K-alpha3|p90-RSK2|pp90RSK2 |
| Gene description: | ribosomal protein S6 kinase, 90kDa, polypeptide 3 |
| Immunogen: | Recombinant protein corresponding to human RPS6KA3. |
| Immunogen sequence/protein sequence: | MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/mL) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human colon with RPS6KA3 polyclonal antibody (Cat # PAB29387) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution. |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |