| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC,IF |
| Brand: | Abnova |
| Reference: | PAB28747 |
| Product name: | MEIS2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant MEIS2. |
| Isotype: | IgG |
| Gene id: | 4212 |
| Gene name: | MEIS2 |
| Gene alias: | HsT18361|MGC2820|MRG1 |
| Gene description: | Meis homeobox 2 |
| Immunogen: | Recombinant protein corresponding to amino acids of human MEIS2. |
| Immunogen sequence/protein sequence: | LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/ml) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human pancreas with MEIS2 polyclonal antibody (Cat # PAB28747) shows strong nuclear positivity at 1:200-1:500 dilution. |
| Applications: | IHC,IF |
| Shipping condition: | Dry Ice |