NXF3 polyclonal antibody View larger

NXF3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NXF3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC

More info about NXF3 polyclonal antibody

Brand: Abnova
Reference: PAB28740
Product name: NXF3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NXF3.
Isotype: IgG
Gene id: 56000
Gene name: NXF3
Gene alias: -
Gene description: nuclear RNA export factor 3
Immunogen: Recombinant protein corresponding to amino acids of human NXF3.
Immunogen sequence/protein sequence: NPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSPRATLCGTEAHKRL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28740-32-12-1.jpg
Application image note: Immunohistochemical staining of human testis with NXF3 polyclonal antibody (Cat # PAB28740) shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts, Leydig cells expressed moderate cytoplasmic staining at 1:50-1:200 dilution.
Applications: IHC
Shipping condition: Dry Ice

Reviews

Buy NXF3 polyclonal antibody now

Add to cart